PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9211_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 325aa    MW: 34704.1 Da    PI: 7.3248
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9211_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.8e-392990263
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                k++al+cprC+s ntkfCyynnysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+sss
  RrC9211_p2 29 KDQALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGIRKNKRSSS 90
                7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.6E-333087IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-253081IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4353387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MNETCLRQSN PAAAAAAAAP VEKKAKPEKD QALNCPRCNS LNTKFCYYNN YSLTQPRYFC  60
KDCKRYWTQG GSLRNIPIGG GIRKNKRSSS SSNSSSSSSS KKTLFADNKT PPPLQQLNLK  120
TAENNHVAAA AKVQELAYSH GLGNAHEAKD LNSAFSQGFG IGHHHHQSIP EFLQVAPSSA  180
LVSTSSALEL LGISNSSATS SNSHPTFVTY PNVHDSSVYT AASPGFGLSY PQFQEFMRPP  240
LEFSLDGGDP LRQEEGSSGT DIGRPLLPFE SLKLHVSSSS TNSGGANGND HEREKEEGEA  300
DNSVGFWNGM LSAGDSTASA GGPWQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00210DAPTransfer from AT1G64620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112847.11e-171PREDICTED: dof zinc finger protein DOF1.8
SwissprotQ84JQ81e-138DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLM4EG091e-171M4EG09_BRARP; Uncharacterized protein
STRINGBra027722.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149321720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.11e-124Dof family protein